PPAPDC3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256028-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256028 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PPAPDC3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
C9orf67, chromosome 9 open reading frame 67, EC 3.1.3, EC 3.1.3.-, FLJ14662, KIAA0515, MGC12921, NET39, phosphatidic acid phosphatase type 2 domain containing 3, Phosphatidic acid phosphatase type 2 domain-containing protein 3, probable lipid phosphate phosphatase PPAPDC3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
84814
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PLPP7
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PPAPDC3 Polyclonal specifically detects PPAPDC3 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: PPAPDC3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: C9orf67, chromosome 9 open reading frame 67, EC 3.1.3, EC 3.1.3.-, FLJ14662, KIAA0515, MGC12921, NET39, phosphatidic acid phosphatase type 2 domain containing 3, Phosphatidic acid phosphatase type 2 domain-containing protein 3, probable lipid phosphate phosphatase PPAPDC3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84814
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PLPP7
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: C9orf67, chromosome 9 open reading frame 67, EC 3.1.3, EC 3.1.3.-, FLJ14662, KIAA0515, MGC12921, NET39, phosphatidic acid phosphatase type 2 domain containing 3, Phosphatidic acid phosphatase type 2 domain-containing protein 3, probable lipid phosphate ph
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 84814
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: R3HDML
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: Cysteine-rich secretory protein R3HDML, dJ881L22.3, MGC129564, peptidase inhibitor R3HDML, R3H domain (binds single-stranded nucleic acids) containing-like, R3H domain containing-like
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 140902
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: R3HDML
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLLSGLEVPRYRRKRHISVRDMNALLDYHNHIRASVYPPAANM
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.