SMNDC1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256111-Each-of-1 | In Stock | ₹ 55,847.50 |
NBP256111 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,847.50
GST (18%): ₹ 10,052.55
Total Price: ₹ 65,900.05
Antigen
SMNDC1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
SMNRSMN-related protein, SPF30splicing factor 30, survival of motor neuron-related, survival motor neuron domain containing 1,30 kDa splicing factor SMNrp, Survival motor neuron domain-containing protein 1, survival of motor neuron-related-splicing factor 30
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SMNDC1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMA
Quantity
100 μL
Research Discipline
Apoptosis
Gene ID (Entrez)
10285
Target Species
Human
Isotype
IgG
Related Products
Description
- SMNDC1 Polyclonal specifically detects SMNDC1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SMNDC1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: SMNRSMN-related protein, SPF30splicing factor 30, survival of motor neuron-related, survival motor neuron domain containing 1,30 kDa splicing factor SMNrp, Survival motor neuron domain-containing protein 1, survival of motor neuron-related-splicing factor 30
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SMNDC1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMA
Quantity: 100 μL
Research Discipline: Apoptosis
Gene ID (Entrez): 10285
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: SMNRSMN-related protein, SPF30splicing factor 30, survival of motor neuron-related, survival motor neuron domain containing 1,30 kDa splicing factor SMNrp, Survival motor neuron domain-containing protein 1, survival of motor neuron-related-splicing factor
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 10285
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: LIM and senescent cell antigen-like domains 1, LIM and senescent cell antigen-like-containing domain protein 1, PINCH-1, PINCHPINCH1Particularly interesting new Cys-His protein 1, Renal carcinoma antigen NY-REN-48
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 3987
Target Species: __
Isotype: __