TERT Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256116-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256116 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
TERT
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Gene Alias
EST2Telomerase-associated protein 2, hEST2, TCS1EC 2.7.7.49, Telomerase catalytic subunit, telomerase reverse transcriptase, TP2HEST2, TRTEC 2.7.7
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TERT
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS
Quantity
100 μL
Research Discipline
Autophagy, Cancer, Cellular Markers, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Embryonic Stem Cell Markers, Mitophagy, Stem Cell Markers
Gene ID (Entrez)
7015
Target Species
Human
Isotype
IgG
Related Products
Description
- TERT Polyclonal specifically detects TERT in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TERT
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Gene Alias: EST2Telomerase-associated protein 2, hEST2, TCS1EC 2.7.7.49, Telomerase catalytic subunit, telomerase reverse transcriptase, TP2HEST2, TRTEC 2.7.7
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TERT
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS
Quantity: 100 μL
Research Discipline: Autophagy, Cancer, Cellular Markers, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Embryonic Stem Cell Markers, Mitophagy, Stem Cell Markers
Gene ID (Entrez): 7015
Target Species: Human
Isotype: IgG
Antigen: SHF
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Src homology 2 domain containing F
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SHF
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SPGHRKRASPKGSLSSAQPHSWMLTPSPLNSHCAHREPISSSPQPVANGPKQKKKSNWRSTTRLRIIRLRD
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 90525
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Src homology 2 domain containing F
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 90525
Target Species: __
Isotype: __
