Cdc27 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256172-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256172 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Cdc27
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
ANAPC3CDC27 homolog, anaphase promoting complex subunit 3, Anaphase-promoting complex subunit 3, anaphase-promoting complex, protein 3, APC 3, APC3cell division cycle 27, CDC27Hs, cell division cycle 27 homolog (S. cerevisiae), cell division cycle protein 27 homolog, D0S1430E, D17S978E, HNUC, H-NUC, NUC2, nuc2 homolog
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CDC27
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS
Quantity
100 μL
Research Discipline
Cell Cycle and Replication
Gene ID (Entrez)
996
Target Species
Human
Isotype
IgG
Related Products
Description
- Cdc27 Polyclonal specifically detects Cdc27 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Cdc27
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: ANAPC3CDC27 homolog, anaphase promoting complex subunit 3, Anaphase-promoting complex subunit 3, anaphase-promoting complex, protein 3, APC 3, APC3cell division cycle 27, CDC27Hs, cell division cycle 27 homolog (S. cerevisiae), cell division cycle protein 27 homolog, D0S1430E, D17S978E, HNUC, H-NUC, NUC2, nuc2 homolog
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CDC27
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 996
Target Species: Human
Isotype: IgG
Antigen: PRAF1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DNA-directed RNA polymerase I subunit E, DNA-directed RNA polymerase I subunit RPA49, FLJ13390, FLJ13970, FLJ43482, PAF53RNA polymerase I-associated factor 1, polymerase (RNA) I associated factor 1, polymerase (RNA) I polypeptide E, 53kDa, PRAF1, RNA polymerase I associated factor 53, RNA polymerase I subunit A49, RNA polymerase I-associated factor 53, RP11-405L18.3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: POLR1E
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 64425
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: DNA-directed RNA polymerase I subunit E, DNA-directed RNA polymerase I subunit RPA49, FLJ13390, FLJ13970, FLJ43482, PAF53RNA polymerase I-associated factor 1, polymerase (RNA) I associated factor 1, polymerase (RNA) I polypeptide E, 53kDa, PRAF1, RNA poly
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 64425
Target Species: __
Isotype: __