NLRC5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256201-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256201 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
NLRC5
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Caterpiller Protein 16.1, CLR16.1, NLR Family CARD Domain Containing 5, NOD27, NOD4, NOD-Like Receptor C5, Nucleotide-Binding Oligomerization Domain Protein 27, Nucleotide-Binding Oligomerization Domain Protein 4, Nucleotide-Binding Oligomerization Domains 27, Protein NLRC5
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
84166
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NLRC5
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSDQ
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- NLRC5 Polyclonal specifically detects NLRC5 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: NLRC5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Caterpiller Protein 16.1, CLR16.1, NLR Family CARD Domain Containing 5, NOD27, NOD4, NOD-Like Receptor C5, Nucleotide-Binding Oligomerization Domain Protein 27, Nucleotide-Binding Oligomerization Domain Protein 4, Nucleotide-Binding Oligomerization Domains 27, Protein NLRC5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84166
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NLRC5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSDQ
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: Caterpiller Protein 16.1, CLR16.1, NLR Family CARD Domain Containing 5, NOD27, NOD4, NOD-Like Receptor C5, Nucleotide-Binding Oligomerization Domain Protein 27, Nucleotide-Binding Oligomerization Domain Protein 4, Nucleotide-Binding Oligomerization Domain
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 84166
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: COX7A2L
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: COX7ARcytochrome c oxidase subunit VII-related protein, COX7a-related protein, COX7RPmitochondrial, cytochrome c oxidase subunit VIIa polypeptide 2 like, Cytochrome c oxidase subunit VIIa-related protein, estrogen receptor binding CpG island, SIG81
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 9167
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: COX7A2L
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.