TRERF1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256238-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256238 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
TRERF1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
BCAR2, Breast cancer estrogen resistance 2RAPAHSA277276, dJ139D8.5, FLJ21198, rapa-1, rapa-2, RP1-139D8.5, transcriptional regulating factor 1, transcriptional regulating protein 132, transcriptional-regulating factor 1, Transcriptional-regulating protein 132, TReP-132, TREP132, Zinc finger protein rapa, Zinc finger transcription factor TReP-132
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
55809
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TRERF1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- TRERF1 Polyclonal specifically detects TRERF1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TRERF1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: BCAR2, Breast cancer estrogen resistance 2RAPAHSA277276, dJ139D8.5, FLJ21198, rapa-1, rapa-2, RP1-139D8.5, transcriptional regulating factor 1, transcriptional regulating protein 132, transcriptional-regulating factor 1, Transcriptional-regulating protein 132, TReP-132, TREP132, Zinc finger protein rapa, Zinc finger transcription factor TReP-132
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55809
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TRERF1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4, ADAM metallopeptidase with thrombospondin type 1 motif, 4, ADAM-TS 4, ADAMTS-2, ADAM-TS4, ADAMTS-4, ADMP-1EC 3.4.24.82, aggrecanase-1, EC 3.4.24, KIAA0688A disint
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 9507
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: IRF2BPL
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: C14orf4, EAP1, IRF2BPL interferon regulatory factor 2 binding protein-like
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 64207
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: IRF2BPL
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLRKRKASPEPPDSAEGALKLGEEQQRQQWMANQSEALKLTMSAG
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.