OR2C3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256247-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256247 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
OR2C3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30, olfactory receptor, family 2, subfamily C, member 3, olfactory receptor, family 2, subfamily C, member 4, olfactory receptor, family 2, subfamily C, member 5 pseudogene, OR2C4, OR2C5P, OST742
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
81472
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
OR2C3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MMEIANVSSPEVFVLLGFSTRPSLE
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- OR2C3 Polyclonal specifically detects OR2C3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: OR2C3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30, olfactory receptor, family 2, subfamily C, member 3, olfactory receptor, family 2, subfamily C, member 4, olfactory receptor, family 2, subfamily C, member 5 pseudogene, OR2C4, OR2C5P, OST742
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 81472
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: OR2C3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MMEIANVSSPEVFVLLGFSTRPSLE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: olfactory receptor 2C3, Olfactory receptor 2C4, Olfactory receptor 2C5, Olfactory receptor OR1-30, olfactory receptor, family 2, subfamily C, member 3, olfactory receptor, family 2, subfamily C, member 4, olfactory receptor, family 2, subfamily C, member
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 81472
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: HEATR3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: FLJ20718, HEAT repeat containing 3, HEAT repeat-containing protein 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55027
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HEATR3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNGDDLIEDDEMEGISHKRRVRRKTFVSDLLPPTDKELRETIALLTAQQTALEIIVNMCCNEDPSDDEWEELSSSDE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.