Reg3A Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256285-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256285 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Reg3A
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5068
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
REG3A
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Reg3A Polyclonal specifically detects Reg3A in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Reg3A
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5068
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: REG3A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 5068
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: RBBP4/RbAp48
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CAF-1 subunit C, CAF-I p48, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, chromatin assembly factor/CAF-1 p48 subunit, histone-binding protein RBBP4, MSI1 protein homolog, Nucleosome-remodeling factor subunit RBAP48, NURF55, RbAp48, RBBP-4, retinoblastoma binding protein 4, Retinoblastoma-binding protein 4CAF-I 48 kDa subunit, Retinoblastoma-binding protein p48
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5928
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RBBP4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.