RFC1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256364-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256364 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
RFC1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
A1, A1 140 kDa subunit, Activator 1 140 kDa subunit, Activator 1 large subunit, Activator 1 subunit 1, MGC51786, MHC binding factor, beta, MHCBFB, PO-GA, RECC1, replication factor C (activator 1) 1 (145kD), replication factor C (activator 1) 1, 145kDa, Replication factor C 140 kDa subunit, Replication factor C large subunit, replication factor C subunit 1, replication factor C1, RFC, RF-C 140 kDa subunit, RFC140DNA-binding protein PO-GA
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
RFC1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
Quantity
100 μL
Research Discipline
Cell Cycle and Replication, DNA Repair
Gene ID (Entrez)
5981
Target Species
Human
Isotype
IgG
Related Products
Description
- RFC1 Polyclonal specifically detects RFC1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: RFC1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: A1, A1 140 kDa subunit, Activator 1 140 kDa subunit, Activator 1 large subunit, Activator 1 subunit 1, MGC51786, MHC binding factor, beta, MHCBFB, PO-GA, RECC1, replication factor C (activator 1) 1 (145kD), replication factor C (activator 1) 1, 145kDa, Replication factor C 140 kDa subunit, Replication factor C large subunit, replication factor C subunit 1, replication factor C1, RFC, RF-C 140 kDa subunit, RFC140DNA-binding protein PO-GA
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RFC1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, DNA Repair
Gene ID (Entrez): 5981
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: A1, A1 140 kDa subunit, Activator 1 140 kDa subunit, Activator 1 large subunit, Activator 1 subunit 1, MGC51786, MHC binding factor, beta, MHCBFB, PO-GA, RECC1, replication factor C (activator 1) 1 (145kD), replication factor C (activator 1) 1, 145kDa, Re
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 5981
Target Species: __
Isotype: __
Antigen: C2orf49
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: ashwin, asw, chromosome 2 open reading frame 49, FLJ45759, MGC5509
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: C2ORF49
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSSTSTSIKVKKTENGDNDRLKPPPQASFTSNAFRKLSNSSSSVSPLILSSNLPVNNKTEHNNNDAKQNHDLTHRKSPSGPVKSPPLSPVGT
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 79074
Target Species: Human
Isotype: IgG