HYDIN1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256377-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256377 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
HYDIN1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CILD5, HYDIN, Axonemal Central Pair Apparatus Protein, HYDIN2, Hydrocephalus Inducing, Hydrocephalus Inducing Homolog (Mouse), Hydrocephalus-Inducing Protein Homolog, KIAA1864, PPP1R31, Protein Phosphatase 1, Protein Phosphatase 1, Regulatory Subunit 31, Regulatory Subunit 31
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
54768
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
HYDIN
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VGQNVIGQGRLSTDTLGKLASEMTLVAPEIKPGKSVRGSVVITKSKADSHGSGSQKQHHSHQSETPQISSSPLPPGPIHRWLSVSPSVG
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- HYDIN1 Polyclonal specifically detects HYDIN1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: HYDIN1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CILD5, HYDIN, Axonemal Central Pair Apparatus Protein, HYDIN2, Hydrocephalus Inducing, Hydrocephalus Inducing Homolog (Mouse), Hydrocephalus-Inducing Protein Homolog, KIAA1864, PPP1R31, Protein Phosphatase 1, Protein Phosphatase 1, Regulatory Subunit 31, Regulatory Subunit 31
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 54768
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HYDIN
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VGQNVIGQGRLSTDTLGKLASEMTLVAPEIKPGKSVRGSVVITKSKADSHGSGSQKQHHSHQSETPQISSSPLPPGPIHRWLSVSPSVG
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: CILD5, HYDIN, Axonemal Central Pair Apparatus Protein, HYDIN2, Hydrocephalus Inducing, Hydrocephalus Inducing Homolog (Mouse), Hydrocephalus-Inducing Protein Homolog, KIAA1864, PPP1R31, Protein Phosphatase 1, Protein Phosphatase 1, Regulatory Subunit 31,
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 54768
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: TSC1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: KIAA0243MGC86987, LAMhamartin, TSC, tuberous sclerosis 1, Tuberous sclerosis 1 protein, tumor suppressor
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 7248
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TSC1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDYVHISLPQATVTPPRKEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAISRELSEITT
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.