ARAP1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256429-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256429 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ARAP1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1, centaurin, delta 2, Centaurin-delta-2, CENTD2ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containingprotein 1, cnt-d2, KIAA0782centaurin-delta-2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ARAP1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK
Quantity
100 μL
Research Discipline
Cell Cycle and Replication
Gene ID (Entrez)
116985
Target Species
Human
Isotype
IgG
Related Products
Description
- ARAP1 Polyclonal specifically detects ARAP1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ARAP1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1, centaurin, delta 2, Centaurin-delta-2, CENTD2ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containingprotein 1, cnt-d2, KIAA0782centaurin-delta-2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ARAP1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 116985
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1, centaurin, delta 2, Centaurin-delta-2, CENTD2ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containin
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 116985
Target Species: __
Isotype: __
Antigen: PDP3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: KIAA1990, PDPr, Pyruvate Dehydrogenase Phosphatase Regulatory Subunit, Pyruvate Dehydrogenase Phosphatase Regulatory Subunit, Mitochondrial
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PDPR
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAG
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 55066
Target Species: Human
Isotype: IgG