SDCCAG10 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256438-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256438 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SDCCAG10
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Antigen NY-CO-10, CWC27 spliceosome-associated protein homolog (S. cerevisiae), EC 5.2.1.8, NY-CO-10, peptidyl-prolyl cis-trans isomerase SDCCAG10, PPIase CWC27, PPIase SDCCAG10, SDCCAG10, Serologically defined colon cancer antigen 10peptidyl-prolyl cis-trans isomerase CWC27 homolog
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
10283
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CWC27
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description SDCCAG10 Polyclonal specifically detects SDCCAG10 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SDCCAG10
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Antigen NY-CO-10, CWC27 spliceosome-associated protein homolog (S. cerevisiae), EC 5.2.1.8, NY-CO-10, peptidyl-prolyl cis-trans isomerase SDCCAG10, PPIase CWC27, PPIase SDCCAG10, SDCCAG10, Serologically defined colon cancer antigen 10peptidyl-prolyl cis-trans isomerase CWC27 homolog
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10283
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CWC27
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: Antigen NY-CO-10, CWC27 spliceosome-associated protein homolog (S. cerevisiae), EC 5.2.1.8, NY-CO-10, peptidyl-prolyl cis-trans isomerase SDCCAG10, PPIase CWC27, PPIase SDCCAG10, SDCCAG10, Serologically defined colon cancer antigen 10peptidyl-prolyl cis-t
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 10283
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: CCM2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: C7orf22OSM, cerebral cavernous malformation 2, Cerebral cavernous malformations 2 protein, chromosome 7 open reading frame 22, malcavernin, MGC4067, MGC4607, MGC74868
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 83605
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CCM2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDVEALGCSMDQDS
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.