AP4M1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256456-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256456 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
AP4M1
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
Adapter-related protein complex 4 mu-1 subunit, adaptor-related protein complex 4, mu 1 subunit, adaptor-related protein complex AP-4 mu4 subunit, AP-4 adapter complex mu subunit, AP-4 complex subunit mu-1, CPSQ3, Mu subunit of AP-4, mu4, MU-4, Mu4-adaptin, Mu-adaptin-related protein 2, mu-adaptin-related protein-2, MUARP2, MU-ARP2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
9179
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
AP4M1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- AP4M1 Polyclonal specifically detects AP4M1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: AP4M1
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: Adapter-related protein complex 4 mu-1 subunit, adaptor-related protein complex 4, mu 1 subunit, adaptor-related protein complex AP-4 mu4 subunit, AP-4 adapter complex mu subunit, AP-4 complex subunit mu-1, CPSQ3, Mu subunit of AP-4, mu4, MU-4, Mu4-adaptin, Mu-adaptin-related protein 2, mu-adaptin-related protein-2, MUARP2, MU-ARP2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 9179
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: AP4M1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: Adapter-related protein complex 4 mu-1 subunit, adaptor-related protein complex 4, mu 1 subunit, adaptor-related protein complex AP-4 mu4 subunit, AP-4 adapter complex mu subunit, AP-4 complex subunit mu-1, CPSQ3, Mu subunit of AP-4, mu4, MU-4, Mu4-adapti
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 9179
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: ST8SIA3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Alpha-2,8-sialyltransferase 8C, Alpha-2,8-sialyltransferase III, EC 2.4.99.-, sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase, Sialyltransferase 8C, sialyltransferase 8C (alpha2,3Galbeta1,4GlcNAcalpha 2,8-sialyltransferase), Sialytransferase St8Sia III, SIAT8-C, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3SIAT8C, ST8SiaIII
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 51046
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ST8SIA3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.