SUCLA2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256491-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256491 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SUCLA2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
A-BETA, ATP-specific succinyl-CoA synthetase subunit beta, beta subunit, EC 6.2.1, EC 6.2.1.5, mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta, MTDPS5, Renal carcinoma antigen NY-REN-39, succinate-CoA ligase, ADP-forming, beta subunit, succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SUCLA2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERD
Quantity
100 μL
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
8803
Target Species
Human
Isotype
IgG
Related Products
Description
- SUCLA2 Polyclonal specifically detects SUCLA2 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SUCLA2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: A-BETA, ATP-specific succinyl-CoA synthetase subunit beta, beta subunit, EC 6.2.1, EC 6.2.1.5, mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta, MTDPS5, Renal carcinoma antigen NY-REN-39, succinate-CoA ligase, ADP-forming, beta subunit, succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SUCLA2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERD
Quantity: 100 μL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 8803
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: A-BETA, ATP-specific succinyl-CoA synthetase subunit beta, beta subunit, EC 6.2.1, EC 6.2.1.5, mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta, MTDPS5, Renal carcinoma antigen NY-REN-39, succinate-CoA ligase, ADP-forming, beta subunit, succin
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8803
Target Species: __
Isotype: __
Antigen: ZNF621
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp686B11107, FLJ23786, FLJ45246, MGC126668, zinc finger protein 621
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZNF621
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNPNL
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 285268
Target Species: Human
Isotype: IgG
