XRCC3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256545-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256545 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
XRCC3
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CMM6, DNA repair protein XRCC3, X-ray repair complementing defective repair in Chinese hamster cells 3, X-ray repair cross-complementing protein 3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
XRCC3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV
Quantity
100 μL
Research Discipline
Apoptosis, Cancer, DNA Repair, Genes Sensitive to DNA Damaging Agents, Homologous Recombination, Tumor Suppressors
Gene ID (Entrez)
7517
Target Species
Human
Isotype
IgG
Related Products
Description
- XRCC3 Polyclonal specifically detects XRCC3 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: XRCC3
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CMM6, DNA repair protein XRCC3, X-ray repair complementing defective repair in Chinese hamster cells 3, X-ray repair cross-complementing protein 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: XRCC3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV
Quantity: 100 μL
Research Discipline: Apoptosis, Cancer, DNA Repair, Genes Sensitive to DNA Damaging Agents, Homologous Recombination, Tumor Suppressors
Gene ID (Entrez): 7517
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CMM6, DNA repair protein XRCC3, X-ray repair complementing defective repair in Chinese hamster cells 3, X-ray repair cross-complementing protein 3
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 7517
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: interferon regulatory factor 2 binding protein 2, IRF-2-binding protein 2
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 359948
Target Species: __
Isotype: __