Nucleoporin NUP85 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256709-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256709 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Nucleoporin NUP85
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
85 kDa nucleoporin, FLJ12549, frount, nuclear pore complex protein Nup85, nucleoporin 85kDa, Nucleoporin Nup75, Nucleoporin Nup85, Nup75, PCNT, PCNT1, Pericentrin-1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
79902
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NUP85
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Nucleoporin NUP85 Polyclonal specifically detects Nucleoporin NUP85 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Nucleoporin NUP85
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 85 kDa nucleoporin, FLJ12549, frount, nuclear pore complex protein Nup85, nucleoporin 85kDa, Nucleoporin Nup75, Nucleoporin Nup85, Nup75, PCNT, PCNT1, Pericentrin-1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 79902
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NUP85
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: ZNF57
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Zinc finger protein 424ZNF424, zinc finger protein 57
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 126295
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZNF57
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGQKSHECQSYSKAFSCQVILSKTSESTH
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: KIAA1329VPS10 domain receptor protein, sortilin-related VPS10 domain containing receptor 2, VPS10 domain-containing receptor SorCS2
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 57537
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.