HLA DPB1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256722-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256722 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
HLA DPB1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility complex, class II, DP beta 1, MHC class II antigen beta chain, MHC class II antigen DP beta 1 chain, MHC class II antigen DPB1, MHC class II antigen DPbeta1, MHC class II HLA-DP-beta, MHC HLA DPB1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
HLA-DPB1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATPENYVYQLRQECYAFNGTQRFLE
Quantity
100 μL
Research Discipline
Asthma, Diabetes Research, Immunology
Gene ID (Entrez)
3115
Target Species
Human
Isotype
IgG
Related Products
Description
- HLA DPB1 Polyclonal specifically detects HLA DPB1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: HLA DPB1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility complex, class II, DP beta 1, MHC class II antigen beta chain, MHC class II antigen DP beta 1 chain, MHC class II antigen DPB1, MHC class II antigen DPbeta1, MHC class II HLA-DP-beta, MHC HLA DPB1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HLA-DPB1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATPENYVYQLRQECYAFNGTQRFLE
Quantity: 100 μL
Research Discipline: Asthma, Diabetes Research, Immunology
Gene ID (Entrez): 3115
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 3115
Target Species: __
Isotype: __
Antigen: TRIM52
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: MGC16175, RING finger protein 102, RNF102tripartite motif-containing 52, tripartite motif containing 52, tripartite motif-containing protein 52
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TRIM52
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEE
Quantity: 100 μL
Research Discipline: Zinc Finger
Gene ID (Entrez): 84851
Target Species: Human
Isotype: IgG