BMAL1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256754-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256754 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
BMAL1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
aryl hydrocarbon receptor nuclear translocator-like, aryl hydrocarbon receptor nuclear translocator-like protein 1, basic-helix-loop-helix-PAS orphan MOP3, BHLHE5, bHLHe5brain and muscle, bHLH-PAS protein JAP3, BMAL1TIC, Brain and muscle ARNT-like 1, Class E basic helix-loop-helix protein 5, Member of PAS protein 3, member of PAS superfamily 3, MOP3BMAL1c, PAS domain-containing protein 3, PASD3MGC47515
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ARNTL
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
Quantity
100 μL
Research Discipline
Cholesterol Metabolism, Chromatin Research, Circadian Rhythm, Hypoxia, Lipid and Metabolism, Neuroscience, Transcription Factors and Regulators, Vision
Gene ID (Entrez)
406
Target Species
Human
Isotype
IgG
Related Products
Description
- BMAL1 Polyclonal specifically detects BMAL1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: BMAL1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: aryl hydrocarbon receptor nuclear translocator-like, aryl hydrocarbon receptor nuclear translocator-like protein 1, basic-helix-loop-helix-PAS orphan MOP3, BHLHE5, bHLHe5brain and muscle, bHLH-PAS protein JAP3, BMAL1TIC, Brain and muscle ARNT-like 1, Class E basic helix-loop-helix protein 5, Member of PAS protein 3, member of PAS superfamily 3, MOP3BMAL1c, PAS domain-containing protein 3, PASD3MGC47515
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ARNTL
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
Quantity: 100 μL
Research Discipline: Cholesterol Metabolism, Chromatin Research, Circadian Rhythm, Hypoxia, Lipid and Metabolism, Neuroscience, Transcription Factors and Regulators, Vision
Gene ID (Entrez): 406
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: aryl hydrocarbon receptor nuclear translocator-like, aryl hydrocarbon receptor nuclear translocator-like protein 1, basic-helix-loop-helix-PAS orphan MOP3, BHLHE5, bHLHe5brain and muscle, bHLH-PAS protein JAP3, BMAL1TIC, Brain and muscle ARNT-like 1, Clas
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 406
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: EF-2, EF2EEF-2, elongation factor 2, eukaryotic translation elongation factor 2, polypeptidyl-tRNA translocase
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 1938
Target Species: __
Isotype: __
