Adenine Nucleotide Translocator 2 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256762-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256762 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Adenine Nucleotide Translocator 2
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Adenine nucleotide translocator 2, adenine nucleotide translocator 2 (fibroblast), ADP, ADP/ATP carrier protein, ADP/ATP translocase 2, ANT2AAC2, 2F1, ATP carrier protein 2, ATP carrier protein, fibroblast isoform, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 5, Solute carrier family 25 member 5, T2, T3ANT 2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SLC25A5
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AAVSKTAVAPIERVKLLLQVQHASKQIS
Quantity
100 μL
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
292
Target Species
Human
Isotype
IgG
Related Products
Description
- Adenine Nucleotide Translocator 2 Polyclonal specifically detects Adenine Nucleotide Translocator 2 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Adenine Nucleotide Translocator 2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Adenine nucleotide translocator 2, adenine nucleotide translocator 2 (fibroblast), ADP, ADP/ATP carrier protein, ADP/ATP translocase 2, ANT2AAC2, 2F1, ATP carrier protein 2, ATP carrier protein, fibroblast isoform, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 5, Solute carrier family 25 member 5, T2, T3ANT 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SLC25A5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AAVSKTAVAPIERVKLLLQVQHASKQIS
Quantity: 100 μL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 292
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Adenine nucleotide translocator 2, adenine nucleotide translocator 2 (fibroblast), ADP, ADP/ATP carrier protein, ADP/ATP translocase 2, ANT2AAC2, 2F1, ATP carrier protein 2, ATP carrier protein, fibroblast isoform, solute carrier family 25 (mitochondrial
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 292
Target Species: __
Isotype: __
Antigen: GRK5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.7.11, EC 2.7.11.16, FLJ39780, G protein-coupled receptor kinase 5, G protein-coupled receptor kinase GRK5, GPRK5FP2025
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GRK5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVHEYL
Quantity: 100 μL
Research Discipline: Protein Kinase
Gene ID (Entrez): 2869
Target Species: Human
Isotype: IgG