IMP3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256774-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256774 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
IMP3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
BRMS2mitochondrial ribosomal protein S4, C15orf12, chromosome 15 open reading frame 12, FLJ10968, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast), MRPS4DKFZp586L0118, U3 small nucleolar ribonucleoprotein protein IMP3, U3 snoRNP protein 3 homolog, U3 snoRNP protein IMP3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
IMP3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
Quantity
100 μL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
55272
Target Species
Human
Isotype
IgG
Related Products
Description
- IMP3 Polyclonal specifically detects IMP3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: IMP3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: BRMS2mitochondrial ribosomal protein S4, C15orf12, chromosome 15 open reading frame 12, FLJ10968, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast), MRPS4DKFZp586L0118, U3 small nucleolar ribonucleoprotein protein IMP3, U3 snoRNP protein 3 homolog, U3 snoRNP protein IMP3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: IMP3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
Quantity: 100 μL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 55272
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: BRMS2mitochondrial ribosomal protein S4, C15orf12, chromosome 15 open reading frame 12, FLJ10968, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast), MRPS4DKFZp586L0118, U3 small nucleolar ribonucleoprotein protein IMP3, U3 snoRNP protein 3 homol
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 55272
Target Species: __
Isotype: __
Antigen: FGFR2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: BBDS, BEK, BFR-1, CD332, CD332 antigen, CEK3, CFD1, craniofacial dysostosis 1, EC 2.7.10, EC 2.7.10.1, ECT1, fibroblast growth factor receptor 2, FLJ98662, Jackson-Weiss syndrome, JWS, Keratinocyte growth factor receptorreceptor like 14, KGFR, K-sam, KSAM, soluble FGFR4 variant 4, TK14, TK25
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FGFR2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKR
Quantity: 100 μL
Research Discipline: Angiogenesis, Protein Kinase
Gene ID (Entrez): 2263
Target Species: Human
Isotype: IgG