ZDHHC7 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256799-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256799 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
ZDHHC7
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 2.3.1, EC 2.3.1.-, FLJ10792, FLJ20279, palmitoyltransferase ZDHHC7, Sertoli cell gene with zinc finger domain- and #946, SERZ1, SERZ-B, Zinc finger DHHC domain-containing protein 7, Zinc finger protein 370, zinc finger, DHHC domain containing 7, zinc finger, DHHC-type containing 7, ZNF370DHHC-7
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
55625
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ZDHHC7
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ZDHHC7 Polyclonal specifically detects ZDHHC7 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ZDHHC7
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.3.1, EC 2.3.1.-, FLJ10792, FLJ20279, palmitoyltransferase ZDHHC7, Sertoli cell gene with zinc finger domain- and #946, SERZ1, SERZ-B, Zinc finger DHHC domain-containing protein 7, Zinc finger protein 370, zinc finger, DHHC domain containing 7, zinc finger, DHHC-type containing 7, ZNF370DHHC-7
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55625
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZDHHC7
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 2.3.1, EC 2.3.1.-, FLJ10792, FLJ20279, palmitoyltransferase ZDHHC7, Sertoli cell gene with zinc finger domain- and #946, SERZ1, SERZ-B, Zinc finger DHHC domain-containing protein 7, Zinc finger protein 370, zinc finger, DHHC domain containing 7, zinc f
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 55625
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: C15orf61
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Chromosome 15 Open Reading Frame 61
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 145853
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: C15orf61
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNWPVQ
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.