PIBF1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256805-Each-of-1 | In Stock | ₹ 55,847.50 |
NBP256805 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,847.50
GST (18%): ₹ 10,052.55
Total Price: ₹ 65,900.05
Antigen
PIBF1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
C13orf24, chromosome 13 open reading frame 24, KIAA1008, PIBF, progesterone immunomodulatory binding factor 1, progesterone-induced blocking factor 1, progesterone-induced-blocking factor 1, RP11-505F3.1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
10464
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PIBF1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PIBF1 Polyclonal specifically detects PIBF1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PIBF1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: C13orf24, chromosome 13 open reading frame 24, KIAA1008, PIBF, progesterone immunomodulatory binding factor 1, progesterone-induced blocking factor 1, progesterone-induced-blocking factor 1, RP11-505F3.1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10464
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PIBF1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: C13orf24, chromosome 13 open reading frame 24, KIAA1008, PIBF, progesterone immunomodulatory binding factor 1, progesterone-induced blocking factor 1, progesterone-induced-blocking factor 1, RP11-505F3.1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 10464
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: ZRANB2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Oocyte-specific maternal effect factor, zygote arrest 1, zygote arrest protein 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 9406
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZRANB2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEDEDDADLSKYNLDASEEEDSNKKKSNRRSRS
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.