TGF beta induced factor 2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256813-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256813 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TGF beta induced factor 2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor homeobox 2, transcription growth factor-beta-induced factor 2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TGIF2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF
Quantity
100 μL
Research Discipline
Angiogenesis, Cancer, Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
60436
Target Species
Human
Isotype
IgG
Related Products
Description
- TGF beta induced factor 2 Polyclonal specifically detects TGF beta induced factor 2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TGF beta induced factor 2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor homeobox 2, transcription growth factor-beta-induced factor 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TGIF2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF
Quantity: 100 μL
Research Discipline: Angiogenesis, Cancer, Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 60436
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 60436
Target Species: __
Isotype: __
Antigen: TMEM184A
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ24011, transmembrane protein 184A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TMEM184A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSE
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 202915
Target Species: Human
Isotype: IgG