MYST1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256864-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256864 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
MYST1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
FLJ14040, hMOFhistone acetyltransferase MYST1, KAT8, MOFEC 2.3.1.48, MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1, MYST histone acetyltransferase 1, MYST-1, ortholog of Drosophila males absent on the first (MOF), probable histone acetyltransferase MYST1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
KAT8
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE
Quantity
100 μL
Research Discipline
Chromatin Research, DNA Repair
Gene ID (Entrez)
84148
Target Species
Human
Isotype
IgG
Related Products
Description
- MYST1 Polyclonal specifically detects MYST1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: MYST1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ14040, hMOFhistone acetyltransferase MYST1, KAT8, MOFEC 2.3.1.48, MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1, MYST histone acetyltransferase 1, MYST-1, ortholog of Drosophila males absent on the first (MOF), probable histone acetyltransferase MYST1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: KAT8
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE
Quantity: 100 μL
Research Discipline: Chromatin Research, DNA Repair
Gene ID (Entrez): 84148
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: FLJ14040, hMOFhistone acetyltransferase MYST1, KAT8, MOFEC 2.3.1.48, MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1, MYST histone acetyltransferase 1, MYST-1, ortholog of Drosophila males absent on the first (MOF), probable histone acetyltransferase MYST1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 84148
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: MCT6MCT 6, MCT7MCT 7, Monocarboxylate transporter 6, monocarboxylate transporter 7, solute carrier family 16 (monocarboxylic acid transporters), member 6, Solute carrier family 16 member 6, solute carrier family 16, member 6 (monocarboxylic acid transport
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 9120
Target Species: __
Isotype: __