Exosome component 5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256887-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256887 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Exosome component 5
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CML28, exosome complex exonuclease RRP46, exosome component 5Chronic myelogenous leukemia tumor antigen 28, exosome component Rrp46, hRrp46p, MGC12901, p12BMGC111224, RRP41B, Rrp46p, RRP46Ribosomal RNA-processing protein 46
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
EXOSC5
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI
Quantity
100 μL
Research Discipline
DNA replication Transcription Translation and Splicing, Epigenetics
Gene ID (Entrez)
56915
Target Species
Human
Isotype
IgG
Related Products
Description
- Exosome component 5 Polyclonal specifically detects Exosome component 5 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Exosome component 5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CML28, exosome complex exonuclease RRP46, exosome component 5Chronic myelogenous leukemia tumor antigen 28, exosome component Rrp46, hRrp46p, MGC12901, p12BMGC111224, RRP41B, Rrp46p, RRP46Ribosomal RNA-processing protein 46
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: EXOSC5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI
Quantity: 100 μL
Research Discipline: DNA replication Transcription Translation and Splicing, Epigenetics
Gene ID (Entrez): 56915
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CML28, exosome complex exonuclease RRP46, exosome component 5Chronic myelogenous leukemia tumor antigen 28, exosome component Rrp46, hRrp46p, MGC12901, p12BMGC111224, RRP41B, Rrp46p, RRP46Ribosomal RNA-processing protein 46
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 56915
Target Species: __
Isotype: __
Antigen: PAX8
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: paired box 8, paired box gene 8, paired box protein Pax-8, paired domain gene 8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PAX8
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGY
Quantity: 100 μL
Research Discipline: Cancer
Gene ID (Entrez): 7849
Target Species: Human
Isotype: IgG