Ets-1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256897-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256897 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Ets-1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, ets protein, ETS-1, EWSR2, FLJ10768, p54, protein C-ets-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ETS1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
Quantity
100 μL
Research Discipline
Cancer, Cell Cycle and Replication, Chromatin Research, Innate Immunity, Transcription Factors and Regulators
Gene ID (Entrez)
2113
Target Species
Human
Isotype
IgG
Related Products
Description
- Ets-1 Polyclonal specifically detects Ets-1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Ets-1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, ets protein, ETS-1, EWSR2, FLJ10768, p54, protein C-ets-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ETS1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS
Quantity: 100 μL
Research Discipline: Cancer, Cell Cycle and Replication, Chromatin Research, Innate Immunity, Transcription Factors and Regulators
Gene ID (Entrez): 2113
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, ets protein, ETS-1, EWSR2, FLJ10768, p54, protein C-ets-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1, v-ets erythroblast
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 2113
Target Species: __
Isotype: __
Antigen: FACA/FANCA
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FA, FA1, FAAMGC75158, FACAFanconi anemia group A protein, FAH, FA-H, FANCH, Fanconi anemia, complementation group A, Fanconi anemia, complementation group H, Fanconi anemia, type 1, Protein FACA
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FANCA
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF
Quantity: 100 μL
Research Discipline: Cancer, DNA Repair, Genes Sensitive to DNA Damaging Agents
Gene ID (Entrez): 2175
Target Species: Human
Isotype: IgG