RNASEH2C Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256902-Each-of-1 | In Stock | ₹ 53,988.36 |
NBP256902 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,988.36
GST (18%): ₹ 9,717.905
Total Price: ₹ 63,706.265
Antigen
RNASEH2C
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias
AGS3RNase H2 subunit C, Aicardi-Goutieres syndrome 3 protein, AYP1FLJ20974, MGC22934, ribonuclease H2 subunit C, ribonuclease H2, subunit C, Ribonuclease HI subunit C, RNase H1 small subunit
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
84153
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
RNASEH2C
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVM
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Description
- RNASEH2C Polyclonal specifically detects RNASEH2C in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: RNASEH2C
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias: AGS3RNase H2 subunit C, Aicardi-Goutieres syndrome 3 protein, AYP1FLJ20974, MGC22934, ribonuclease H2 subunit C, ribonuclease H2, subunit C, Ribonuclease HI subunit C, RNase H1 small subunit
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 84153
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RNASEH2C
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVM
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: AGS3RNase H2 subunit C, Aicardi-Goutieres syndrome 3 protein, AYP1FLJ20974, MGC22934, ribonuclease H2 subunit C, ribonuclease H2, subunit C, Ribonuclease HI subunit C, RNase H1 small subunit
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 84153
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: collagen alpha 6 type IV, collagen alpha-6(IV) chain, collagen IV, alpha-6 polypeptide, collagen of basement membrane, alpha-6, collagen, type IV, alpha 6, CXDELq22.3, DELXq22.3, dJ889N15.4 (Collagen Alpha 6(IV)), EC 2.7.7.8, MGC88184
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 1288
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.