MKLP1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256923-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256923 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
MKLP1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
kinesin family member 23, kinesin-like 5 (mitotic kinesin-like protein 1), Kinesin-like protein 5, kinesin-like protein KIF23, KNSL5CHO1, mitotic kinesin-like 1, MKLP-1, MKLP1Mitotic kinesin-like protein 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
KIF23
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL
Quantity
100 μL
Research Discipline
Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Gene ID (Entrez)
9493
Target Species
Human
Isotype
IgG
Related Products
Description
- MKLP1 Polyclonal specifically detects MKLP1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: MKLP1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: kinesin family member 23, kinesin-like 5 (mitotic kinesin-like protein 1), Kinesin-like protein 5, kinesin-like protein KIF23, KNSL5CHO1, mitotic kinesin-like 1, MKLP-1, MKLP1Mitotic kinesin-like protein 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: KIF23
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Gene ID (Entrez): 9493
Target Species: Human
Isotype: IgG
Antigen: CDK2AP1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1, CDKAP1, cyclin-dependent kinase 2 associated protein 1, Deleted in oral cancer 1, Deleted in oral cancer-1, doc-1, DOC1Putative oral cancer suppressor, DORC1, p12DOC-1, ST19
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CDK2AP1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
Quantity: 100 μL
Research Discipline: Breast Cancer, Cancer
Gene ID (Entrez): 8099
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1, CDKAP1, cyclin-dependent kinase 2 associated protein 1, Deleted in oral cancer 1, Deleted in oral cancer-1, doc-1, DOC1Putative oral cancer suppressor, DORC1, p12DOC-1, ST19
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8099
Target Species: __
Isotype: __