ORC4L Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256938-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256938 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ORC4L
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
HsORC4, ORC4LFLJ46668, ORC4P, origin recognition complex subunit 4, origin recognition complex, subunit 4, origin recognition complex, subunit 4 (yeast homolog)-like, origin recognition complex, subunit 4 homolog, origin recognition complex, subunit 4 homolog (S. cerevisiae), origin recognition complex, subunit 4-like, origin recognition complex, subunit 4-like (S. cerevisiae), origin recognition complex, subunit 4-like (yeast)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5000
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ORC4
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Description
- ORC4L Polyclonal specifically detects ORC4L in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ORC4L
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: HsORC4, ORC4LFLJ46668, ORC4P, origin recognition complex subunit 4, origin recognition complex, subunit 4, origin recognition complex, subunit 4 (yeast homolog)-like, origin recognition complex, subunit 4 homolog, origin recognition complex, subunit 4 homolog (S. cerevisiae), origin recognition complex, subunit 4-like, origin recognition complex, subunit 4-like (S. cerevisiae), origin recognition complex, subunit 4-like (yeast)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5000
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ORC4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: HsORC4, ORC4LFLJ46668, ORC4P, origin recognition complex subunit 4, origin recognition complex, subunit 4, origin recognition complex, subunit 4 (yeast homolog)-like, origin recognition complex, subunit 4 homolog, origin recognition complex, subunit 4 hom
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 5000
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: SFMBT1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp434L243, Renal ubiquitous protein 1, RU1scm-like with four MBT domains protein 1, Scm-like with four mbt domains 1, Scm-related gene containing four mbt domains, Scm-related gene product containing four mbt domains, SFMBT
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 51460
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SFMBT1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YTHYYGKKKNKRIGRPPGGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGS
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.