Presenilin-1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257002-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257002 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Presenilin-1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
AD3EC 3.4.23.-, Alzheimer disease 3, EC 3.4.23, FAD, presenilin 1, Protein S182, PS-1, PS1presenilin-1, PSNL1, S182
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PSEN1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ
Quantity
100 μL
Research Discipline
Alzheimers Research, Apoptosis, Cancer, Hematopoietic Stem Cell Markers, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission, Stem Cell Markers, Stem Cell Signaling Pathway, Tumor Suppressors, Wnt Signaling Pathway
Gene ID (Entrez)
5663
Target Species
Human
Isotype
IgG
Related Products
Description
- Presenilin-1 Polyclonal specifically detects Presenilin-1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Presenilin-1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: AD3EC 3.4.23.-, Alzheimer disease 3, EC 3.4.23, FAD, presenilin 1, Protein S182, PS-1, PS1presenilin-1, PSNL1, S182
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PSEN1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQ
Quantity: 100 μL
Research Discipline: Alzheimers Research, Apoptosis, Cancer, Hematopoietic Stem Cell Markers, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Neurotransmission, Stem Cell Markers, Stem Cell Signaling Pathway, Tumor Suppressors, Wnt Signaling Pathway
Gene ID (Entrez): 5663
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: AD3EC 3.4.23.-, Alzheimer disease 3, EC 3.4.23, FAD, presenilin 1, Protein S182, PS-1, PS1presenilin-1, PSNL1, S182
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 5663
Target Species: __
Isotype: __
Antigen: SLC35D3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: bA55K22.3, frc, fringe-like 1, FRCL1, Fringe connection-like protein 1, MGC102873, solute carrier family 35 member D3, solute carrier family 35, member D3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SLC35D3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVLIQKASADTEHGPLTAQYV
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 340146
Target Species: Human
Isotype: IgG
