PKR Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257020-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP257020 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
PKR
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
double stranded RNA activated protein kinase, EC 2.7.11.1, eIF-2A protein kinase 2, EIF2AK1, eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase, interferon-induced, double-stranded RNA-activated protein kinase, interferon-inducible double stranded RNA dependent, interferon-inducible elF2alpha kinase, Interferon-inducible RNA-dependent protein kinase, PKRp68 kinase, PRKRMGC126524, Protein kinase RNA-activated
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
EIF2AK2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVD
Quantity
100 μL
Research Discipline
Apoptosis, Signal Transduction
Gene ID (Entrez)
5610
Target Species
Human
Isotype
IgG
Related Products
Description
- PKR Polyclonal specifically detects PKR in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PKR
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: double stranded RNA activated protein kinase, EC 2.7.11.1, eIF-2A protein kinase 2, EIF2AK1, eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase, interferon-induced, double-stranded RNA-activated protein kinase, interferon-inducible double stranded RNA dependent, interferon-inducible elF2alpha kinase, Interferon-inducible RNA-dependent protein kinase, PKRp68 kinase, PRKRMGC126524, Protein kinase RNA-activated
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: EIF2AK2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVD
Quantity: 100 μL
Research Discipline: Apoptosis, Signal Transduction
Gene ID (Entrez): 5610
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Homeobox protein Hox-7, homeobox protein MSX-1, HOX7homeobox 7, HYD1msh homeobox homolog 1 (Drosophila), msh (Drosophila) homeo box homolog 1 (formerly homeo box 7), msh homeo box 1, msh homeobox 1, Msh homeobox 1-like protein, msh homeobox homolog 1, OFC
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 4487
Target Species: __
Isotype: __
Antigen: Argonaute 4
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: AGO4argonaute 4, Argonaute4, eIF2C 4, eIF-2C 4, Eukaryotic translation initiation factor 2C 4, eukaryotic translation initiation factor 2C, 4, FLJ20033, hAgo4, KIAA1567argonaute4, protein argonaute-4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: AGO4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQWVSVVSLQLLLEALAGHLNEVPDDSVQALDVITRH
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 192670
Target Species: Human
Isotype: IgG