BAP1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257089-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP257089 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
BAP1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase), BRCA1-associated protein 1, Cerebral protein 6, cerebral protein-13, cerebral protein-6, DKFZp686N04275, EC 3.4.19.12, FLJ35406, FLJ37180, hucep-6, KIAA0272HUCEP-13, ubiquitin carboxyl-terminal hydrolase BAP1, ubiquitin carboxy-terminal hydrolase, UCHL2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
BAP1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMV
Quantity
100 μL
Research Discipline
Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, DNA Repair, Tumor Suppressors
Gene ID (Entrez)
8314
Target Species
Human
Isotype
IgG
Related Products
Description
- BAP1 Polyclonal specifically detects BAP1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: BAP1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase), BRCA1-associated protein 1, Cerebral protein 6, cerebral protein-13, cerebral protein-6, DKFZp686N04275, EC 3.4.19.12, FLJ35406, FLJ37180, hucep-6, KIAA0272HUCEP-13, ubiquitin carboxyl-terminal hydrolase BAP1, ubiquitin carboxy-terminal hydrolase, UCHL2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: BAP1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMV
Quantity: 100 μL
Research Discipline: Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, DNA Repair, Tumor Suppressors
Gene ID (Entrez): 8314
Target Species: Human
Isotype: IgG
Antigen: SLC17A4
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: KAIA2138, KIAA2138, MGC129623, Na/PO4 cotransporter, putative small intestine sodium-dependent phosphate transport protein, solute carrier family 17 (sodium phosphate), member 4, Solute carrier family 17 member 4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SLC17A4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YDDPVNHPFISAGEKRYIVCSLAQQDCSPGWSLPIRA
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 10050
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: KAIA2138, KIAA2138, MGC129623, Na/PO4 cotransporter, putative small intestine sodium-dependent phosphate transport protein, solute carrier family 17 (sodium phosphate), member 4, Solute carrier family 17 member 4
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 10050
Target Species: __
Isotype: __
