NBP257195

EED Antibody, Novus Biologicals™

Manufacturer: Fischer Scientific

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP257195-Each-of-1 In Stock ₹ 55,271.76

NBP257195 - Each of 1

₹ 55,271.76

In Stock

Quantity

1

Base Price: ₹ 55,271.76

GST (18%): ₹ 9,948.917

Total Price: ₹ 65,220.677

Antigen

EED

Classification

Polyclonal

Dilution

Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias

embryonic ectoderm development, HEED, polycomb protein EED, WAIT1, WAIT-1, WD protein associating with integrin cytoplasmic tails 1

Host Species

Rabbit

Purification Method

Affinity Purified

Regulatory Status

RUO

Primary or Secondary

Primary

Test Specificity

Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications

Western Blot, Immunocytochemistry, Immunofluorescence

Conjugate

Unconjugated

Formulation

PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols

EED

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPL

Quantity

100 μL

Research Discipline

DNA replication Transcription Translation and Splicing

Gene ID (Entrez)

8726

Target Species

Human

Isotype

IgG

Related Products

Img

Fischer Scientific

NBP257116

--

Img

Fischer Scientific

NBP257238

--

Img

Fischer Scientific

NBP257317

--

Img

Fischer Scientific

NBP257857

--

Img

Fischer Scientific

NBP257351

--

Img

Fischer Scientific

NBP257412

--

Img

Fischer Scientific

NB403713

--

Img

Fischer Scientific

NB403712

--

Description

  • EED Polyclonal specifically detects EED in Human samples
  • It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Compare Similar Items

Show Difference

Img

Fischer Scientific

NBP257195

--


Antigen:
EED

Classification:
Polyclonal

Dilution:
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias:
embryonic ectoderm development, HEED, polycomb protein EED, WAIT1, WAIT-1, WD protein associating with integrin cytoplasmic tails 1

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications:
Western Blot, Immunocytochemistry, Immunofluorescence

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
EED

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPL

Quantity:
100 μL

Research Discipline:
DNA replication Transcription Translation and Splicing

Gene ID (Entrez):
8726

Target Species:
Human

Isotype:
IgG

Img

Novus Biologicals™

NBP257195PE

--


Antigen:
__

Classification:
__

Dilution:
__

Gene Alias:
embryonic ectoderm development, HEED, polycomb protein EED, WAIT1, WAIT-1, WD protein associating with integrin cytoplasmic tails 1

Host Species:
__

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Regulatory Status:
RUO

Primary or Secondary:
__

Test Specificity:
__

Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.

Applications:
__

Conjugate:
__

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbols:
__

Immunogen:
__

Quantity:
100μL

Research Discipline:
__

Gene ID (Entrez):
8726

Target Species:
__

Isotype:
__

Img

Fischer Scientific

NBP257196

--


Antigen:
NLRP1/NALP1

Classification:
Polyclonal

Dilution:
Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias:
CARD7SLEV1, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament-forming ced-4-like apoptosis protein, DEFCAPVAMAS1, DKFZp586O1822, KIAA0926DEFCAP-L/S, NACHT, leucine rich repeat and PYD (pyrin domain) containing 1, NACHT, leucine rich repeat and PYD containing 1, NACHT, LRR and PYD containing protein 1, NACHT, LRR and PYD domains-containing protein 1, NACPP1044, NALP1caspase recruitment domain protein 7, NLR family, pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications:
Immunocytochemistry, Immunofluorescence

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
NLRP1

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRK

Quantity:
100 μL

Research Discipline:
Apoptosis

Gene ID (Entrez):
22861

Target Species:
Human

Isotype:
IgG

Img

Fischer Scientific

NBP257197

--


Antigen:
MAPKAPK2

Classification:
Polyclonal

Dilution:
Immunohistochemistry-Paraffin 1:200 - 1:500

Gene Alias:
EC 2.7.11, EC 2.7.11.1, MAP kinase-activated protein kinase 2, MAPK-activated protein kinase 2, MAPKAP kinase 2, MAPKAPK-2, mitogen-activated protein kinase-activated protein kinase 2, MK2

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications:
Immunohistochemistry (Paraffin)

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
MAPKAPK2

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL

Quantity:
100 μL

Research Discipline:
Breast Cancer, Cancer, MAP Kinase Signaling, Protein Kinase, Signal Transduction

Gene ID (Entrez):
9261

Target Species:
Human

Isotype:
IgG