NBP257239

PICK1 Antibody, Novus Biologicals™

Manufacturer: Fischer Scientific

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP257239-Each-of-1 In Stock ₹ 53,688.90

NBP257239 - Each of 1

₹ 53,688.90

In Stock

Quantity

1

Base Price: ₹ 53,688.90

GST (18%): ₹ 9,664.002

Total Price: ₹ 63,352.902

Antigen

PICK1

Classification

Polyclonal

Dilution

Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias

alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein

Host Species

Rabbit

Purification Method

Affinity Purified

Regulatory Status

RUO

Primary or Secondary

Primary

Test Specificity

Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications

Immunocytochemistry, Immunofluorescence

Conjugate

Unconjugated

Formulation

PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols

PICK1

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD

Quantity

100 μL

Research Discipline

Signal Transduction, Transcription Factors and Regulators, Vision

Gene ID (Entrez)

9463

Target Species

Human

Isotype

IgG

Description

  • PICK1 Polyclonal specifically detects PICK1 in Human samples
  • It is validated for Immunocytochemistry/Immunofluorescence.

Compare Similar Items

Show Difference

Img

Fischer Scientific

NBP257239

--


Antigen:
PICK1

Classification:
Polyclonal

Dilution:
Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias:
alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications:
Immunocytochemistry, Immunofluorescence

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
PICK1

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD

Quantity:
100 μL

Research Discipline:
Signal Transduction, Transcription Factors and Regulators, Vision

Gene ID (Entrez):
9463

Target Species:
Human

Isotype:
IgG

Img

Novus Biologicals™

NBP257239PE

--


Antigen:
__

Classification:
__

Dilution:
__

Gene Alias:
alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein

Host Species:
__

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Regulatory Status:
RUO

Primary or Secondary:
__

Test Specificity:
__

Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.

Applications:
__

Conjugate:
__

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbols:
__

Immunogen:
__

Quantity:
100μL

Research Discipline:
__

Gene ID (Entrez):
9463

Target Species:
__

Isotype:
__

Img

Fischer Scientific

NBP257240

--


Antigen:
DNA Polymerase epsilon catalytic subunit A

Classification:
Polyclonal

Dilution:
Immunocytochemistry/Immunofluorescence 1-4 ug/ml

Gene Alias:
DKFZp434F222, DNA polymerase epsilon catalytic subunit A, DNA polymerase II subunit A, EC 2.7.7, EC 2.7.7.7, POLE1FLJ21434, polymerase (DNA directed), epsilon

Host Species:
Rabbit

Purification Method:
Affinity Purified

Regulatory Status:
RUO

Primary or Secondary:
Primary

Test Specificity:
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications:
Immunocytochemistry, Immunofluorescence

Conjugate:
Unconjugated

Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide

Gene Symbols:
POLE

Immunogen:
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEAHLIQRWFEHVQETKPTIMVTYNGDFFDWPFVEARAAVHGLSMQQEI

Quantity:
100 μL

Research Discipline:
Chromatin Research, DNA Polymerases, DNA Repair

Gene ID (Entrez):
5426

Target Species:
Human

Isotype:
IgG

Img

Novus Biologicals™

NBP257240PE

--


Antigen:
__

Classification:
__

Dilution:
__

Gene Alias:
DKFZp434F222, DNA polymerase epsilon catalytic subunit A, DNA polymerase II subunit A, EC 2.7.7, EC 2.7.7.7, POLE1FLJ21434, polymerase (DNA directed), epsilon

Host Species:
__

Purification Method:
>80% by SDS-PAGE and Coomassie blue staining

Regulatory Status:
RUO

Primary or Secondary:
__

Test Specificity:
__

Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.

Applications:
__

Conjugate:
__

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbols:
__

Immunogen:
__

Quantity:
100μL

Research Discipline:
__

Gene ID (Entrez):
5426

Target Species:
__

Isotype:
__