Manufacturer: Fischer Scientific
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257239-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257239 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
PICK1
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
alpha binding protein, dJ1039K5, MGC15204, PICK, PRKCA-binding protein, PRKCABPprotein interacting with PRKCA, Protein interacting with C kinase 1, protein interacting with PRKCA 1, Protein kinase C-alpha-binding protein
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
PICK1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD
100 μL
Signal Transduction, Transcription Factors and Regulators, Vision
9463
Human
IgG