GPR177/WLS Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257299-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257299 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
GPR177/WLS
Classification
Polyclonal
Dilution
Western Blot 1:100 - 1:250, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
C1orf139, DKFZp686I0788, EVIchromosome 1 open reading frame 139, FLJ23091, G protein-coupled receptor 177, GPR177wls, Integral membrane protein GPR177, MGC131760, MGC14878, MRP, Protein evenness interrupted homolog, protein wntless homolog, Putative NF-kappa-B-activating protein 373, putative NFkB activating protein 373, wntless homolog (Drosophila)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
WLS
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
Quantity
100 μL
Research Discipline
Signal Transduction
Gene ID (Entrez)
79971
Target Species
Human
Isotype
IgG
Related Products
Description
- GPR177/WLS Polyclonal specifically detects GPR177/WLS in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GPR177/WLS
Classification: Polyclonal
Dilution: Western Blot 1:100 - 1:250, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: C1orf139, DKFZp686I0788, EVIchromosome 1 open reading frame 139, FLJ23091, G protein-coupled receptor 177, GPR177wls, Integral membrane protein GPR177, MGC131760, MGC14878, MRP, Protein evenness interrupted homolog, protein wntless homolog, Putative NF-kappa-B-activating protein 373, putative NFkB activating protein 373, wntless homolog (Drosophila)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: WLS
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 79971
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: C1orf139, DKFZp686I0788, EVIchromosome 1 open reading frame 139, FLJ23091, G protein-coupled receptor 177, GPR177wls, Integral membrane protein GPR177, MGC131760, MGC14878, MRP, Protein evenness interrupted homolog, protein wntless homolog, Putative NF-ka
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 79971
Target Species: __
Isotype: __
Antigen: CCDC36
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Cancer/testis antigen 74, coiled-coil domain containing 36, coiled-coil domain-containing protein 36, CT74FLJ25320
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CCDC36
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LCDPREHLVIKQKDGTVEMRGKDKKQQPRKAHRAHRGRLIASKQKQIPIQTCKFNSKYQSPQPAISVPQSPFLGQQEPRAQPLHLQCPR
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 339834
Target Species: Human
Isotype: IgG