FAM59B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257306-Each-of-1 | In Stock | ₹ 55,847.50 |
NBP257306 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,847.50
GST (18%): ₹ 10,052.55
Total Price: ₹ 65,900.05
Antigen
FAM59B
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
FAM59B, Family With Sequence Similarity 59, Member B, GAREML, GRB2 Associated, Regulator Of MAPK1-Like, GRB2-Associated And Regulator Of MAPK Protein-Like, GRB2-Associated And Regulator Of MAPK1-Like, KIAA2038, Protein FAM59B
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
150946
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GAREM2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- FAM59B Polyclonal specifically detects FAM59B in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: FAM59B
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FAM59B, Family With Sequence Similarity 59, Member B, GAREML, GRB2 Associated, Regulator Of MAPK1-Like, GRB2-Associated And Regulator Of MAPK Protein-Like, GRB2-Associated And Regulator Of MAPK1-Like, KIAA2038, Protein FAM59B
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 150946
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GAREM2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:REGHCYKLVSIISKTVVLGLALRREGPAPLHFLLLTDTPRFALPQGLLAGDPRVERLVRDSASYCRERFDPDEY
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: FAM59B, Family With Sequence Similarity 59, Member B, GAREML, GRB2 Associated, Regulator Of MAPK1-Like, GRB2-Associated And Regulator Of MAPK Protein-Like, GRB2-Associated And Regulator Of MAPK1-Like, KIAA2038, Protein FAM59B
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 150946
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: DAP Kinase 2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DAP kinase 2, DAP-kinase-related protein 1, DAP-kinase-related protein 1 beta isoform, death-associated protein kinase 2, DRP1, DRP-1MGC119312, EC 2.7.11, EC 2.7.11.1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 23604
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DAPK2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MFQASMRSPNMEPFKQQKVEDFYDIGEEL
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.