Ssu72 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257318-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP257318 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Ssu72
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CTD phosphatase SSU72, EC 3.1.3.16, FLJ13048, HSPC182, PNAS-120, RNA polymerase II subunit A C-terminal domain phosphatase SSU72, SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae), Ssu72 RNA polymerase II CTD phosphatase homolog (yeast)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SSU72
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTY
Quantity
100 μL
Research Discipline
DNA replication Transcription Translation and Splicing, Proteases & Other Enzymes
Gene ID (Entrez)
29101
Target Species
Human
Isotype
IgG
Related Products
Description
- Ssu72 Polyclonal specifically detects Ssu72 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Ssu72
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CTD phosphatase SSU72, EC 3.1.3.16, FLJ13048, HSPC182, PNAS-120, RNA polymerase II subunit A C-terminal domain phosphatase SSU72, SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae), Ssu72 RNA polymerase II CTD phosphatase homolog (yeast)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SSU72
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTY
Quantity: 100 μL
Research Discipline: DNA replication Transcription Translation and Splicing, Proteases & Other Enzymes
Gene ID (Entrez): 29101
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CTD phosphatase SSU72, EC 3.1.3.16, FLJ13048, HSPC182, PNAS-120, RNA polymerase II subunit A C-terminal domain phosphatase SSU72, SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae), Ssu72 RNA polymerase II CTD phosphatase homolog (yeast)
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 29101
Target Species: __
Isotype: __
Antigen: Lipin 3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: dJ450M14.2, dJ450M14.3, dJ620E11.2, EC 3.1.3.4, lipin 3, lipin 3-like, lipin-3, Lipin-3-like, LIPN3L, phosphatidate phosphatase LPIN3, SMP2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: LPIN3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 64900
Target Species: Human
Isotype: IgG