DCLRE1B Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257379-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257379 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
DCLRE1B
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
APOLLO, DKFZp686C24187, DNA cross-link repair 1B, DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae), DNA cross-link repair 1B protein, EC 3.1, FLJ12810, FLJ13998, hSNM1B, PSO2 homolog, SNM1 homolog B, SNM1B5' exonuclease Apollo, SNMIB
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
64858
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
DCLRE1B
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQ
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- DCLRE1B Polyclonal specifically detects DCLRE1B in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: DCLRE1B
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: APOLLO, DKFZp686C24187, DNA cross-link repair 1B, DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae), DNA cross-link repair 1B protein, EC 3.1, FLJ12810, FLJ13998, hSNM1B, PSO2 homolog, SNM1 homolog B, SNM1B5' exonuclease Apollo, SNMIB
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 64858
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DCLRE1B
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQ
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: APOLLO, DKFZp686C24187, DNA cross-link repair 1B, DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae), DNA cross-link repair 1B protein, EC 3.1, FLJ12810, FLJ13998, hSNM1B, PSO2 homolog, SNM1 homolog B, SNM1B5' exonuclease Apollo, SNMIB
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 64858
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: NTNG1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: axon guidance molecule, KIAA0976YLSR571, laminet 1, laminet-1, Lmnt1, netrin G1, netrin G1f, netrin-G1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 22854
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NTNG1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.