GPIP137 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257388-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257388 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
GPIP137
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
activation/proliferation-associated protein 1, caprin 1, caprin-1, cell cycle associated protein 1, Cell cycle-associated protein 1, Cytoplasmic activation- and proliferation-associated protein 1, cytoplasmic activation/proliferation-associated protein-1, GPI-anchored membrane protein 1GPIP137, GPI-p137, M11S1GPI-anchored protein p137, Membrane component chromosome 11 surface marker 1, membrane component, chromosome 11, surface marker 1, p137GPI, RNA granule protein 105, RNG105GPIAP1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
4076
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CAPRIN1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- GPIP137 Polyclonal specifically detects GPIP137 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: GPIP137
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: activation/proliferation-associated protein 1, caprin 1, caprin-1, cell cycle associated protein 1, Cell cycle-associated protein 1, Cytoplasmic activation- and proliferation-associated protein 1, cytoplasmic activation/proliferation-associated protein-1, GPI-anchored membrane protein 1GPIP137, GPI-p137, M11S1GPI-anchored protein p137, Membrane component chromosome 11 surface marker 1, membrane component, chromosome 11, surface marker 1, p137GPI, RNA granule protein 105, RNG105GPIAP1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 4076
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CAPRIN1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: CHST14
Classification: Polyclonal
Dilution: Western Blot 1:250 - 1:500, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: ATCS, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14, D4ST-1, D4ST1carbohydrate sulfotransferase 14, dermatan 4 sulfotransferase 1, Dermatan 4-sulfotransferase 1, EC 2.8.2.-, HD4ST, hD4ST1, HNK1ST
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 113189
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CHST14
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: NAT10
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: ALP, DKFZp434C116, EC 2.3.1.-, FLJ10774, FLJ12179, FLJ23850, hALP, KIAA1709, N-acetyltransferase 10, N-acetyltransferase 10 (GCN5-related), N-acetyltransferase-like protein, NET43
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55226
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NAT10
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAP
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
