MED17 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257476-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257476 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
MED17
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Activator-recruited cofactor 77 kDa component, Cofactor required for Sp1 transcriptional activation subunit 6, cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa, CRSP6FLJ10812, CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD), DRIP77, DRIP80ARC77, mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component, mediator of RNA polymerase II transcription subunit 17, Thyroid hormone receptor-associated protein complex 80 kDa component, Transcriptional coactivator CRSP77, Trap80, TRAP80CRSP complex subunit 6
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
MED17
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKR
Quantity
100 μL
Research Discipline
Signal Transduction
Gene ID (Entrez)
9440
Target Species
Human
Isotype
IgG
Description
- Description MED17 Polyclonal specifically detects MED17 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: MED17
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Activator-recruited cofactor 77 kDa component, Cofactor required for Sp1 transcriptional activation subunit 6, cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa, CRSP6FLJ10812, CRSP77cofactor required for Sp1 transcriptional activation, subunit 6 (77kD), DRIP77, DRIP80ARC77, mediator complex subunit 17Vitamin D3 receptor-interacting protein complex 80 kDa component, mediator of RNA polymerase II transcription subunit 17, Thyroid hormone receptor-associated protein complex 80 kDa component, Transcriptional coactivator CRSP77, Trap80, TRAP80CRSP complex subunit 6
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: MED17
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKR
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 9440
Target Species: Human
Isotype: IgG
Antigen: ATXN1L
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Ankyrin Repeat And SOCS Box Containing 16, Ankyrin Repeat And SOCS Box-Containing 16, ASB-16
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ATXN1L
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AHSFNKAPSATSPSGQLPHHSSTQPLDLAPGRMPIYYQMSRLPAGYTLHETPPAGASPVLTPQESQS
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 92591
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Ankyrin Repeat And SOCS Box Containing 16, Ankyrin Repeat And SOCS Box-Containing 16, ASB-16
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 92591
Target Species: __
Isotype: __
