DEGS1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257505-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257505 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
DEGS1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
8560
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
DEGS1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- DEGS1 Polyclonal specifically detects DEGS1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: DEGS1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte homolog, lipid desaturase, EC 1.14, FADS7, membrane fatty acid (lipid) desaturase, Membrane lipid desaturase, MGC5079, migration-inducing gene 15 protein, MLDdihydroceramide desaturase, sphingolipid delta 4 desaturase, sphingolipid delta(4)-desaturase DES1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 8560
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DEGS1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: Cell migration-inducing gene 15 protein, Degenerative spermatocyte homolog 1, degenerative spermatocyte homolog 1, lipid desaturase (Drosophila), degenerative spermatocyte homolog, lipid desaturase (Drosophila), DEGS, Des-1, DES1degenerative spermatocyte
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 8560
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: WDR59
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: FLJ12270, KIAA1923, MGC11230, WD repeat domain 59, WD repeat-containing protein 59
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 79726
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: WDR59
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSLTYSDPRERERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGIEFGVYCSHCRSEVRGTQCAICKGFTFQCAIC
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.