CD77 Synthase Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257614-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257614 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CD77 Synthase
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group), A4GALT1, alpha 1,4-galactosyltransferase, Alpha-1,4-galactosyltransferase, Alpha-1,4-N-acetylglucosaminyltransferase, alpha4Gal-T1, CD77 synthase, EC 2.4.1.228, Gb3 synthase, Gb3S, Globotriaosylceramide synthase, lactosylceramide 4-alpha-galactosyltransferase, P blood group (P one antigen), P(k), P(k) antigen synthase, P1, P1/Pk synthase, PK, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
53947
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
A4GALT
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD',)
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CD77 Synthase Polyclonal specifically detects CD77 Synthase in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CD77 Synthase
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group), A4GALT1, alpha 1,4-galactosyltransferase, Alpha-1,4-galactosyltransferase, Alpha-1,4-N-acetylglucosaminyltransferase, alpha4Gal-T1, CD77 synthase, EC 2.4.1.228, Gb3 synthase, Gb3S, Globotriaosylceramide synthase, lactosylceramide 4-alpha-galactosyltransferase, P blood group (P one antigen), P(k), P(k) antigen synthase, P1, P1/Pk synthase, PK, UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 53947
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: A4GALT
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD',)
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: cold shock domain containing C2, RNA binding, cold shock domain-containing protein C2, dJ347H13.2, PIPPIN, RNA-binding protein PIPPin
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 27254
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Antigen: FBXL2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FBL2FBL3F-box protein containing leucine-rich repeats, F-box and leucine-rich repeat protein 2DKFZp564P0622, F-box protein FBL2/FBL3, F-box/LRR-repeat protein 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 25827
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FBXL2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SNSTCGHERLRVLELDNCLLI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
