NOD1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257631-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257631 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
NOD1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CARD4NLR family, CARD domain containing 1, caspase recruitment domain family, member 4, Caspase recruitment domain-containing protein 4, CLR7.1, NLRC1, nucleotide-binding oligomerization domain containing 1, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 1, nucleotide-binding oligomerization domain-containing protein 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NOD1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE
Quantity
100 μL
Research Discipline
Apoptosis, Asthma, Autophagy, Immunology
Gene ID (Entrez)
10392
Target Species
Human
Isotype
IgG
Related Products
Description
- NOD1 Polyclonal specifically detects NOD1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: NOD1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CARD4NLR family, CARD domain containing 1, caspase recruitment domain family, member 4, Caspase recruitment domain-containing protein 4, CLR7.1, NLRC1, nucleotide-binding oligomerization domain containing 1, nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 1, nucleotide-binding oligomerization domain-containing protein 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NOD1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE
Quantity: 100 μL
Research Discipline: Apoptosis, Asthma, Autophagy, Immunology
Gene ID (Entrez): 10392
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: C10orf70, CDGSH iron sulfur domain 1, CDGSH iron sulfur domain-containing protein 1, CDGSH iron-sulfur domain-containing protein 1, chromosome 10 open reading frame 70, MDS029, MGC14684, mitoNEET, ZCD1, zinc finger CDGSH-type domain 1, zinc finger, CDGSH-
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 55847
Target Species: __
Isotype: __
Antigen: INT3
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: C1orf193, C1orf60, chromosome 1 open reading frame 60, DKFZp686E1950, DKFZp686O20115, DKFZp781I1253, FLJ21919, FLJ44849, INT3, integrator complex subunit 3, RP11-216N14.4, Sensor of single-strand DNA complex subunit A, sensor of ssDNA A, Sensor of ssDNA subunit A, SOSS complex subunit A, SOSS-A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: INTS3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQP
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 65123
Target Species: Human
Isotype: IgG