PRPF31 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257695-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257695 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PRPF31
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
DKFZp566J153, hPrp31, NY-BR-99, Pre-mRNA-processing factor 31, Protein 61K, PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae), PRP31 pre-mRNA processing factor 31 homolog (yeast), PRP31RP11, Serologically defined breast cancer antigen NY-BR-99, U4/U6 small nuclear ribonucleoprotein Prp31, U4/U6 snRNP 61 kDa protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
26121
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PRPF31
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PRPF31 Polyclonal specifically detects PRPF31 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PRPF31
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp566J153, hPrp31, NY-BR-99, Pre-mRNA-processing factor 31, Protein 61K, PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae), PRP31 pre-mRNA processing factor 31 homolog (yeast), PRP31RP11, Serologically defined breast cancer antigen NY-BR-99, U4/U6 small nuclear ribonucleoprotein Prp31, U4/U6 snRNP 61 kDa protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 26121
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PRPF31
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGN
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: PCGF3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, polycomb group ring finger 3, polycomb group RING finger protein 3, ring finger protein 3, RNF3, RNF3ARING finger protein 3A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10336
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PCGF3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, polycomb group ring finger 3, polycomb group RING finger protein 3, ring finger protein 3, RNF3, RNF3ARING finger protein 3A
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 10336
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles