THAP3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257825-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257825 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
THAP3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
MGC33488, THAP domain containing, apoptosis associated protein 3, THAP domain-containing protein 3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
THAP3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS
Quantity
100 μL
Research Discipline
DNA replication Transcription Translation and Splicing
Gene ID (Entrez)
90326
Target Species
Human
Isotype
IgG
Description
- THAP3 Polyclonal specifically detects THAP3 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: THAP3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: MGC33488, THAP domain containing, apoptosis associated protein 3, THAP domain-containing protein 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: THAP3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNKQPSDHSYALLDLDSLKKKLFLTLKENEKLRKRLQAQRLVMRRMSSRLRACKGHQGLQARLGPEQQS
Quantity: 100 μL
Research Discipline: DNA replication Transcription Translation and Splicing
Gene ID (Entrez): 90326
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: hPrp3, HPRP3P, HPRP3retinitis pigmentosa 18 (autosomal dominant), Pre-mRNA-splicing factor 3, PRP3, PRP3 pre-mRNA processing factor 3 homolog (S. cerevisiae), PRP3 pre-mRNA processing factor 3 homolog (yeast), Prp3p, RP18, U4/U6 small nuclear ribonucleopr
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 9129
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: FHL3, HLH3, HPLH3, MUNC13-4, Munc13-4protein unc-13 homolog D, unc-13 homolog D (C. elegans)
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 201294
Target Species: __
Isotype: __