ADAMTS4 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257839-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257839 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ADAMTS4
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4, ADAM metallopeptidase with thrombospondin type 1 motif, 4, ADAM-TS 4, ADAMTS-2, ADAM-TS4, ADAMTS-4, ADMP-1EC 3.4.24.82, aggrecanase-1, EC 3.4.24, KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ADAMTS4
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP
Quantity
100 μL
Research Discipline
Cancer, GPCR, Neuroscience, Vision
Gene ID (Entrez)
9507
Target Species
Human
Isotype
IgG
Related Products
Description
- ADAMTS4 Polyclonal specifically detects ADAMTS4 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ADAMTS4
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4, ADAM metallopeptidase with thrombospondin type 1 motif, 4, ADAM-TS 4, ADAMTS-2, ADAM-TS4, ADAMTS-4, ADMP-1EC 3.4.24.82, aggrecanase-1, EC 3.4.24, KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ADAMTS4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP
Quantity: 100 μL
Research Discipline: Cancer, GPCR, Neuroscience, Vision
Gene ID (Entrez): 9507
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4, ADAM metallopeptidase with thrombospondin type 1 motif, 4, ADAM-TS 4, ADAMTS-2, ADAM-TS4, ADAMTS-4, ADMP-1EC 3.4.24.82, aggrecanase-1, EC 3.4.24, KIAA0688A disint
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 9507
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: progestin and adipoQ receptor family member 4, progestin and adipoQ receptor family member IVFLJ30002
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 124222
Target Species: __
Isotype: __
