WNK3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257909-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP257909 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
WNK3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 2.7.11, FLJ30437, KIAA1566FLJ42662, PRKWNK3lysine deficient 3, WNK lysine deficient protein kinase 3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
WNK3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('SSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV',)
Quantity
100 μL
Research Discipline
Protein Kinase
Gene ID (Entrez)
65267
Target Species
Human
Isotype
IgG
Related Products
Description
- WNK3 Polyclonal specifically detects WNK3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: WNK3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.7.11, FLJ30437, KIAA1566FLJ42662, PRKWNK3lysine deficient 3, WNK lysine deficient protein kinase 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: WNK3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('SSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV',)
Quantity: 100 μL
Research Discipline: Protein Kinase
Gene ID (Entrez): 65267
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 2.7.11, FLJ30437, KIAA1566FLJ42662, PRKWNK3lysine deficient 3, WNK lysine deficient protein kinase 3
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 65267
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: BHLHA18, bHLHa18Class A basic helix-loop-helix protein 18, lymphoblastic leukemia derived sequence 1, Lymphoblastic leukemia-derived sequence 1, protein lyl-1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 4066
Target Species: __
Isotype: __