CC Chemokine Receptor D6 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257954-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP257954 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
CC Chemokine Receptor D6
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
C-C chemokine receptor D6, CCR10CCR9D6CC-chemokine-binding receptor JAB61, chemokine (C-C) receptor 9, chemokine binding protein 2, Chemokine receptor CCR-10, Chemokine receptor CCR-9, chemokine receptor D6, chemokine-binding protein 2, Chemokine-binding protein D6, CMKBR9chemokine (C-C motif) receptor 9, hD6, MGC126678, MGC138250
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ACKR2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLP
Quantity
100 μL
Research Discipline
Autophagy, Cellular Markers, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction
Gene ID (Entrez)
1238
Target Species
Human
Isotype
IgG
Related Products
Description
- CC Chemokine Receptor D6 Polyclonal specifically detects CC Chemokine Receptor D6 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CC Chemokine Receptor D6
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: C-C chemokine receptor D6, CCR10CCR9D6CC-chemokine-binding receptor JAB61, chemokine (C-C) receptor 9, chemokine binding protein 2, Chemokine receptor CCR-10, Chemokine receptor CCR-9, chemokine receptor D6, chemokine-binding protein 2, Chemokine-binding protein D6, CMKBR9chemokine (C-C motif) receptor 9, hD6, MGC126678, MGC138250
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ACKR2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLP
Quantity: 100 μL
Research Discipline: Autophagy, Cellular Markers, Cytokine Research, GPCR, Immunology, Innate Immunity, Signal Transduction
Gene ID (Entrez): 1238
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: C-C chemokine receptor D6, CCR10CCR9D6CC-chemokine-binding receptor JAB61, chemokine (C-C) receptor 9, chemokine binding protein 2, Chemokine receptor CCR-10, Chemokine receptor CCR-9, chemokine receptor D6, chemokine-binding protein 2, Chemokine-binding
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 1238
Target Species: __
Isotype: __
Antigen: UCH-L5/UCH37
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 3.4.19.12, INO80 complex subunit R, INO80R, ubiquitin carboxyl-terminal esterase L5, ubiquitin carboxyl-terminal hydrolase isozyme L5, ubiquitin carboxyl-terminal hydrolase L5, Ubiquitin C-terminal hydrolase UCH37, Ubiquitin thioesterase L5, UCH37CGI-70, UCH-L5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: UCHL5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 51377
Target Species: Human
Isotype: IgG