STEP Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258008-Each-of-1 | In Stock | ₹ 55,847.50 |
NBP258008 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,847.50
GST (18%): ₹ 10,052.55
Total Price: ₹ 65,900.05
Antigen
STEP
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 3.1.3.48, FLJ14427, Neural-specific protein-tyrosine phosphatase, protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched), protein-tyrosine phosphatase striatum-enriched, STEPPTPSTEP, Striatum-enriched protein-tyrosine phosphatase, tyrosine-protein phosphatase non-receptor type 5
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PTPN5
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY
Quantity
100 μL
Research Discipline
Alzheimers Research, Cancer, Cellular Markers, Hypoxia, Neurodegeneration, Neuroscience, Protein Phosphatase, Signal Transduction
Gene ID (Entrez)
84867
Target Species
Human
Isotype
IgG
Related Products
Description
- STEP Polyclonal specifically detects STEP in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: STEP
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 3.1.3.48, FLJ14427, Neural-specific protein-tyrosine phosphatase, protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched), protein-tyrosine phosphatase striatum-enriched, STEPPTPSTEP, Striatum-enriched protein-tyrosine phosphatase, tyrosine-protein phosphatase non-receptor type 5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PTPN5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHY
Quantity: 100 μL
Research Discipline: Alzheimers Research, Cancer, Cellular Markers, Hypoxia, Neurodegeneration, Neuroscience, Protein Phosphatase, Signal Transduction
Gene ID (Entrez): 84867
Target Species: Human
Isotype: IgG
Antigen: LMX1b
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: LIM homeobox transcription factor 1, beta, LIM homeobox transcription factor 1-beta, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LMX1.2, LMX-1.2, MGC138325, MGC142051, NPS1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: LMX1B
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL
Quantity: 100 μL
Research Discipline: Neuroscience
Gene ID (Entrez): 4010
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: LIM homeobox transcription factor 1, beta, LIM homeobox transcription factor 1-beta, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LMX1.2, LMX-1.2, MGC138325, MGC142051, NPS1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 4010
Target Species: __
Isotype: __