NKp46/NCR1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258055-Each-of-1 | In Stock | ₹ 56,159.00 |
NBP258055 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 56,159.00
GST (18%): ₹ 10,108.62
Total Price: ₹ 66,267.62
Antigen
NKp46/NCR1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CD335, CD335 antigen, hNKp46, LY94lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46), Lymphocyte antigen 94 homolog, natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NKp46, NKP46FLJ99094, NK-p46lymphocyte antigen 94 (mouse) homolog (activating NK-receptor; NK-p46)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NCR1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT
Quantity
100 μL
Research Discipline
Innate Immunity
Gene ID (Entrez)
9437
Target Species
Human
Isotype
IgG
Related Products
Description
- NKp46/NCR1 Polyclonal specifically detects NKp46/NCR1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: NKp46/NCR1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CD335, CD335 antigen, hNKp46, LY94lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46), Lymphocyte antigen 94 homolog, natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NKp46, NKP46FLJ99094, NK-p46lymphocyte antigen 94 (mouse) homolog (activating NK-receptor; NK-p46)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NCR1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT
Quantity: 100 μL
Research Discipline: Innate Immunity
Gene ID (Entrez): 9437
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CD335, CD335 antigen, hNKp46, LY94lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46), Lymphocyte antigen 94 homolog, natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NKp46, NKP46
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 9437
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: FKHL14LD, forkhead box C2 (MFH-1, mesenchyme forkhead 1), forkhead, Drosophila, homolog-like 14, Forkhead-related protein FKHL14, Mesenchyme fork head protein 1, mesenchyme forkhead 1, MFH-1, MFH-1 protein, MFH1forkhead box protein C2, Transcription facto
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 2303
Target Species: __
Isotype: __
